SCOPe 2.08: Domain d7mokb_: 7mok B:

Lineage for d7mokb_ (7mok B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)

6. Protein automated matches [190696] (6 species)
   not a true protein

7. Species Arabidopsis thaliana [TaxId:3702] [422331] (3 PDB entries)

8. Domain d7mokb_: 7mok B: [422332]
   automated match to d2q47a1
   complexed with bme, po4

Details for d7mokb_

PDB Entry: 7mok, 1.85 Å

PDB Description: crystal structure of arabidopsis thaliana plant and fungi atypical dual specificity phosphatase 1(atpfa-dsp1 ) in complex with phosphate in conformation a (pi(a))

PDB Compounds: (B:) Tyrosine-protein phosphatase DSP1

SCOPe Domain Sequences for d7mokb_:

Sequence; same for both SEQRES and ATOM records:

>d7mokb_ c.45.1.1 (B:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
eelhlipplnfsmvdngifrsgfpdsanfsflqtlglrsiiylcpepypesnlqflksng
irlfqfgiegnkepfvnipdhkirmalkvlldeknhpvlihckrgkhrtgclvgclrklq
kwcltsifdeyqrfaaakarvsdqrfmeifdvssfshipmsfscsi

Timeline for d7mokb_:

• d7mokb_ is new in SCOPe 2.08-stable