SCOPe 2.07: Domain d1lti.1: 1lti A:,C:

Lineage for d1lti.1 (1lti A:,C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein Heat-labile toxin, A-chain [56401] (2 species)

7. Species Escherichia coli, type IB [TaxId:562] [56402] (9 PDB entries)

8. Domain d1lti.1: 1lti A:,C: [42233]
   Other proteins in same PDB: d1ltid_, d1ltie_, d1ltif_, d1ltig_, d1ltih_
   complexed with gal

Details for d1lti.1

PDB Entry: 1lti, 2.13 Å

PDB Description: heat-labile enterotoxin (lt-i) complex with t-antigen

PDB Compounds: (A:) heat labile enterotoxin type I, (C:) heat labile enterotoxin type I

SCOPe Domain Sequences for d1lti.1:

Sequence; same for both SEQRES and ATOM records:

>g1lti.1 d.166.1.1 (A:,C:) Heat-labile toxin, A-chain {Escherichia coli, type IB [TaxId: 562]}
rlyradsrppdeikrsgglmprghneyfdrgtqmninlydhargtqtgfvryddgyvsts
lslrsahlagqsilsgystyyiyviatapnmfnvndvlgvysphpyeqevsalggipysq
iygwyrvnfgviderlhrnreyrdryyrnlniapaedgyrlagfppdhqawreepwihha
pqgcgXgdtcneetqnlstiylreyqskvkrqifsdyqsevdiynri

Timeline for d1lti.1:

• d1lti.1 first appeared (with stable ids) in SCOP 1.55
  
• d1lti.1 appears in SCOPe 2.06
  
• d1lti.1 appears in the current release, SCOPe 2.08