SCOPe 2.08: Domain d7dznd2: 7dzn D:115-243

Lineage for d7dznd2 (7dzn D:115-243)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (31 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
Domain d7dznd2: 7dzn D:115-243 [422320]
Other proteins in same PDB: d7dzna1, d7dzna2, d7dznb1, d7dznb2, d7dzne1, d7dzne2
automated match to d2vlme2

Details for d7dznd2

PDB Entry: 7dzn (more details), 2.63 Å

PDB Description: crystal structure of the cross-restricted t18a tcr and hlab4201 bound to hiv-1 gag tl9 peptide

PDB Compounds: (D:) beta chain T18A TCR

SCOPe Domain Sequences for d7dznd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dznd2 b.1.1.0 (D:115-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d7dznd2:

Click to download the PDB-style file with coordinates for d7dznd2.
(The format of our PDB-style files is described here.)

Timeline for d7dznd2: