Lineage for d7e4uc_ (7e4u C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877880Protein automated matches [190100] (21 species)
    not a true protein
  7. 3085986Species Sparus aurata [TaxId:8175] [422303] (1 PDB entry)
  8. 3086001Domain d7e4uc_: 7e4u C: [422318]
    automated match to d2z9sa_
    complexed with ca, gol

Details for d7e4uc_

PDB Entry: 7e4u (more details), 2.6 Å

PDB Description: crystal structure of peroxiredoxin-1
PDB Compounds: (C:) Peroxiredoxin 1

SCOPe Domain Sequences for d7e4uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7e4uc_ c.47.1.10 (C:) automated matches {Sparus aurata [TaxId: 8175]}
agnaqigklapdftakavmpdgqfkdlkmsdyrgkyvvfffypldftfvcpteiiafsda
addfkkigceviaasvdshfshlawintprkqgglgtmkiplvsdtrrtistdygvlked
dgiayrglfiiddkgilrqitindlpvgrsveetlrlvqafqftdkhgevc

SCOPe Domain Coordinates for d7e4uc_:

Click to download the PDB-style file with coordinates for d7e4uc_.
(The format of our PDB-style files is described here.)

Timeline for d7e4uc_:

  • d7e4uc_ is new in SCOPe 2.08-stable