Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein automated matches [190118] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries) |
Domain d7rbsb2: 7rbs B:79-157 [422284] Other proteins in same PDB: d7rbsa1, d7rbsa2, d7rbsb1, d7rbsb3, d7rbsc1, d7rbsc2, d7rbsd1, d7rbsd3, d7rbse1, d7rbse2, d7rbsf1, d7rbsf3, d7rbsg1, d7rbsg2, d7rbsh1, d7rbsh3, d7rbsi1, d7rbsi2, d7rbsj1, d7rbsj3 automated match to d3pseb2 complexed with zn; mutant |
PDB Entry: 7rbs (more details), 2.98 Å
SCOPe Domain Sequences for d7rbsb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7rbsb2 d.15.1.1 (B:79-157) automated matches {Human (Homo sapiens) [TaxId: 9606]} deplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlfwltfegkpledqlplg eyglkplstvfmnlrlrgg
Timeline for d7rbsb2: