Lineage for d7rbsb2 (7rbs B:79-157)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932413Protein automated matches [190118] (16 species)
    not a true protein
  7. 2932448Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries)
  8. 3085967Domain d7rbsb2: 7rbs B:79-157 [422284]
    Other proteins in same PDB: d7rbsa1, d7rbsa2, d7rbsb1, d7rbsb3, d7rbsc1, d7rbsc2, d7rbsd1, d7rbsd3, d7rbse1, d7rbse2, d7rbsf1, d7rbsf3, d7rbsg1, d7rbsg2, d7rbsh1, d7rbsh3, d7rbsi1, d7rbsi2, d7rbsj1, d7rbsj3
    automated match to d3pseb2
    complexed with zn; mutant

Details for d7rbsb2

PDB Entry: 7rbs (more details), 2.98 Å

PDB Description: the crystal structure of papain-like protease of sars cov-2, c111s mutant, in complex with human isg15
PDB Compounds: (B:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d7rbsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7rbsb2 d.15.1.1 (B:79-157) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlfwltfegkpledqlplg
eyglkplstvfmnlrlrgg

SCOPe Domain Coordinates for d7rbsb2:

Click to download the PDB-style file with coordinates for d7rbsb2.
(The format of our PDB-style files is described here.)

Timeline for d7rbsb2:

  • d7rbsb2 is new in SCOPe 2.08-stable