Lineage for d7pcxb1 (7pcx B:4-293)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900279Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)
  6. 2900319Protein automated matches [190880] (5 species)
    not a true protein
  7. 2900347Species Rhodococcus sp. [TaxId:1831] [189207] (19 PDB entries)
  8. 3085962Domain d7pcxb1: 7pcx B:4-293 [422279]
    Other proteins in same PDB: d7pcxa2, d7pcxa3, d7pcxb2, d7pcxb3, d7pcxc2, d7pcxc3, d7pcxd2, d7pcxd3, d7pcxe2, d7pcxe3, d7pcxf2, d7pcxf3
    automated match to d6u32a_
    complexed with cl, gol, oeh

Details for d7pcxb1

PDB Entry: 7pcx (more details), 1.4 Å

PDB Description: x-ray structure of the haloalkane dehalogenase halotag7-q165w labeled with a chloroalkane-tetramethylrhodamine fluorophore substrate
PDB Compounds: (B:) haloalkane dehalogenase

SCOPe Domain Sequences for d7pcxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7pcxb1 c.69.1.8 (B:4-293) automated matches {Rhodococcus sp. [TaxId: 1831]}
igtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssyvwrniiphvapthrcia
pdligmgksdkpdlgyffddhvrfmdafiealgleevvlvihdwgsalgfhwakrnperv
kgiafmefirpiptwdewpefaretfqafrttdvgrkliidwnvfiegtlpmgvvrplte
vemdhyrepflnpvdreplwrfpnelpiagepanivalveeymdwlhqspvpkllfwgtp
gvlippaeaarlakslpnckavdigpglnllqednpdligseiarwlstl

SCOPe Domain Coordinates for d7pcxb1:

Click to download the PDB-style file with coordinates for d7pcxb1.
(The format of our PDB-style files is described here.)

Timeline for d7pcxb1:

  • d7pcxb1 is new in SCOPe 2.08-stable