Lineage for d7s50b_ (7s50 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2688957Protein Phycocyanin beta subunit [88940] (9 species)
  7. 2689006Species Thermosynechococcus elongatus [TaxId:197221] [189583] (12 PDB entries)
  8. 3085886Domain d7s50b_: 7s50 B: [422203]
    Other proteins in same PDB: d7s50a_
    automated match to d1i7yb_
    complexed with cl, cyc, men, na

Details for d7s50b_

PDB Entry: 7s50 (more details), 2.1 Å

PDB Description: serial macromolecular crystallography at alba synchrotron light source - phycocyanin
PDB Compounds: (B:) c-phycocyanin beta subunit

SCOPe Domain Sequences for d7s50b_:

Sequence, based on SEQRES records: (download)

>d7s50b_ a.1.1.3 (B:) Phycocyanin beta subunit {Thermosynechococcus elongatus [TaxId: 197221]}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava

Sequence, based on observed residues (ATOM records): (download)

>d7s50b_ a.1.1.3 (B:) Phycocyanin beta subunit {Thermosynechococcus elongatus [TaxId: 197221]}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqalg
tpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava

SCOPe Domain Coordinates for d7s50b_:

Click to download the PDB-style file with coordinates for d7s50b_.
(The format of our PDB-style files is described here.)

Timeline for d7s50b_:

  • d7s50b_ is new in SCOPe 2.08-stable