Lineage for d7s1ea_ (7s1e A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.1: ARM repeat [48371] (28 families) 
Family a.118.1.1: Armadillo repeat [48372] (7 proteins)
this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
Protein Importin alpha [48376] (2 species) 
Species Cavia porcellus [TaxId:10141] [422192] (1 PDB entry) 
Domain d7s1ea_: 7s1e A: [422193]
automated match to d4yi0c_
Details for d7s1ea_
PDB Entry: 7s1e (more details), 2.35 Å
PDB Description: crystal structure of cavia porcellus (guinea pig) importin-alpha 1 in cargo-free state
PDB Compounds: (A:) importin subunit alphaSCOPe Domain Sequences for d7s1ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7s1ea_ a.118.1.1 (A:) Importin alpha {Cavia porcellus [TaxId: 10141]}
wtvddivkginsnnlenqlqatqaarkllsrekqppidhiiraglipkfvsflgrtdcsp
iqfesawaltniasgsseqtkavvdggaipalisllasphahiseqavwalgniagdgsv
frdlvikygaidpllallavpdmsslaggylrnltwtlsnlcrnknpappldaveqilpt
lvrllhhndlevladtcwaisyltdgpneriemvvktgvvphlvkllgsnelsimtpalr
aignivtgtdeqtqividagalavfpsllvhpktniqkeatwtmsnitagrqdqiqqvvn
hglvpilvsvlskadfktqkeavwavtnytsggtveqivylvhcgiieplmnlltakdtk
iilvildaisnifqaaeklgeteklsimieecggldkiealqnhenesvykaslnlieky
fs
SCOPe Domain Coordinates for d7s1ea_:
Click to download the PDB-style file with coordinates for d7s1ea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d7s1ea_:
- d7s1ea_ is new in SCOPe 2.08-stable
View in 3D
