Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries) |
Domain d7rbsf1: 7rbs F:2-78 [422165] Other proteins in same PDB: d7rbsa2, d7rbsb2, d7rbsb3, d7rbsc2, d7rbsd2, d7rbsd3, d7rbse2, d7rbsf2, d7rbsf3, d7rbsg2, d7rbsh2, d7rbsh3, d7rbsi2, d7rbsj2, d7rbsj3 automated match to d3pseb1 complexed with zn; mutant |
PDB Entry: 7rbs (more details), 2.98 Å
SCOPe Domain Sequences for d7rbsf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7rbsf1 d.15.1.0 (F:2-78) automated matches {Human (Homo sapiens) [TaxId: 9606]} gwdltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvpla sqglgpgstvllvvdkc
Timeline for d7rbsf1: