Lineage for d7l0lk_ (7l0l K:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 3085820Domain d7l0lk_: 7l0l K: [422137]
    automated match to d6ghgl_
    complexed with nag

Details for d7l0lk_

PDB Entry: 7l0l (more details), 2.85 Å

PDB Description: cryo-em structure of the vrc316 clinical trial, vaccine-elicited, human antibody 316-310-1b11 in complex with an h2 can05 ha trimer
PDB Compounds: (K:) 316-310-1B11 Light Chain

SCOPe Domain Sequences for d7l0lk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7l0lk_ b.1.1.0 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgdratlscrasqsvpssylawyrhkpgqaprlliygassratgip
drfsgsgsgtdfsltisrvepedfavyycqqygsspytfgrgtkldik

SCOPe Domain Coordinates for d7l0lk_:

Click to download the PDB-style file with coordinates for d7l0lk_.
(The format of our PDB-style files is described here.)

Timeline for d7l0lk_:

  • d7l0lk_ is new in SCOPe 2.08-stable