Lineage for d7mzke2 (7mzk E:112-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 3085807Domain d7mzke2: 7mzk E:112-213 [422124]
    Other proteins in same PDB: d7mzka1, d7mzka2, d7mzkb1, d7mzkb2, d7mzkc_, d7mzkd1, d7mzke1, d7mzkf_, d7mzkh_, d7mzkl_, d7mzkm_, d7mzkn_
    automated match to d2fb4l2
    complexed with cit, gol, mpd

Details for d7mzke2

PDB Entry: 7mzk (more details), 2.25 Å

PDB Description: sars-cov-2 receptor binding domain bound to fab wcsl 129 and fab pdi 96
PDB Compounds: (E:) WCSL 129 light chain

SCOPe Domain Sequences for d7mzke2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7mzke2 b.1.1.2 (E:112-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d7mzke2:

Click to download the PDB-style file with coordinates for d7mzke2.
(The format of our PDB-style files is described here.)

Timeline for d7mzke2:

  • d7mzke2 is new in SCOPe 2.08-stable