SCOPe 2.08: Domain d7mzke1: 7mzk E:1-111

Lineage for d7mzke1 (7mzk E:1-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d7mzke1: 7mzk E:1-111 [422123]
   Other proteins in same PDB: d7mzka1, d7mzka2, d7mzkb1, d7mzkb2, d7mzkc_, d7mzkd2, d7mzke2, d7mzkf_
   automated match to d2mcg11
   complexed with cit, gol, mpd

Details for d7mzke1

PDB Entry: 7mzk, 2.25 Å

PDB Description: sars-cov-2 receptor binding domain bound to fab wcsl 129 and fab pdi 96

PDB Compounds: (E:) WCSL 129 light chain

SCOPe Domain Sequences for d7mzke1:

Sequence; same for both SEQRES and ATOM records:

>d7mzke1 b.1.1.0 (E:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvltqppsasgtpgqsvsiscsgtysnigsnpvnwyqqvpgtapklliyandqrpsgvp
drfsgsksatsaflaigglqseddadyycstwddslpgplfgggtkltvlg

Timeline for d7mzke1:

• d7mzke1 is new in SCOPe 2.08-stable