Lineage for d7p87a1 (7p87 A:345-507)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2824132Family b.122.1.0: automated matches [191599] (1 protein)
    not a true family
  6. 2824133Protein automated matches [191089] (10 species)
    not a true protein
  7. 2824139Species Human (Homo sapiens) [TaxId:9606] [189059] (71 PDB entries)
  8. 3085774Domain d7p87a1: 7p87 A:345-507 [422091]
    Other proteins in same PDB: d7p87a2, d7p87b2
    automated match to d6zd9b_
    protein/RNA complex; complexed with m4e, so4

Details for d7p87a1

PDB Entry: 7p87 (more details), 1.3 Å

PDB Description: crystal structure of ythdc1 with compound yli_dc1_001
PDB Compounds: (A:) YTH domain-containing protein 1

SCOPe Domain Sequences for d7p87a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7p87a1 b.122.1.0 (A:345-507) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsklkyvlqdarffliksnnhenvslakakgvwstlpvnekklnlafrsarsvilifsvr
esgkfqgfarlsseshhggspihwvlpagmsakmlggvfkidwicrrelpftksahltnp
wnehkpvkigrdgqeielecgtqlcllfppdesidlyqvihkm

SCOPe Domain Coordinates for d7p87a1:

Click to download the PDB-style file with coordinates for d7p87a1.
(The format of our PDB-style files is described here.)

Timeline for d7p87a1:

  • d7p87a1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d7p87a2