Class b: All beta proteins [48724] (180 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (15 families) |
Family b.122.1.0: automated matches [191599] (1 protein) not a true family |
Protein automated matches [191089] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189059] (71 PDB entries) |
Domain d7p87a1: 7p87 A:345-507 [422091] Other proteins in same PDB: d7p87a2, d7p87b2 automated match to d6zd9b_ protein/RNA complex; complexed with m4e, so4 |
PDB Entry: 7p87 (more details), 1.3 Å
SCOPe Domain Sequences for d7p87a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7p87a1 b.122.1.0 (A:345-507) automated matches {Human (Homo sapiens) [TaxId: 9606]} tsklkyvlqdarffliksnnhenvslakakgvwstlpvnekklnlafrsarsvilifsvr esgkfqgfarlsseshhggspihwvlpagmsakmlggvfkidwicrrelpftksahltnp wnehkpvkigrdgqeielecgtqlcllfppdesidlyqvihkm
Timeline for d7p87a1: