Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d7mzkd2: 7mzk D:112-213 [422061] Other proteins in same PDB: d7mzka1, d7mzka2, d7mzkb1, d7mzkb2, d7mzkc_, d7mzkd1, d7mzke1, d7mzkf_, d7mzkh_, d7mzkl_, d7mzkm_, d7mzkn_ automated match to d2fb4l2 complexed with cit, gol, mpd |
PDB Entry: 7mzk (more details), 2.25 Å
SCOPe Domain Sequences for d7mzkd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7mzkd2 b.1.1.2 (D:112-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvapt
Timeline for d7mzkd2: