Lineage for d7l4bj_ (7l4b J:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836165Species Campylobacter jejuni [TaxId:192222] [268320] (5 PDB entries)
  8. 3085699Domain d7l4bj_: 7l4b J: [422016]
    automated match to d3m5va_
    complexed with act, edo, kpi, mg, pge

Details for d7l4bj_

PDB Entry: 7l4b (more details), 2.42 Å

PDB Description: dihydrodipicolinate synthase (dhdps) from c.jejuni with pyruvate bound in the active site in p1211 space group
PDB Compounds: (J:) 4-hydroxy-tetrahydrodipicolinate synthase

SCOPe Domain Sequences for d7l4bj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7l4bj_ c.1.10.0 (J:) automated matches {Campylobacter jejuni [TaxId: 192222]}
kniiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehrtc
ieiavetckgtkvkvlagagsnatheavglakfakehgadgilsvapyynkptqqglyeh
ykaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvxeasgnidkcvdllahe
prmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindelyn
inkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf

SCOPe Domain Coordinates for d7l4bj_:

Click to download the PDB-style file with coordinates for d7l4bj_.
(The format of our PDB-style files is described here.)

Timeline for d7l4bj_:

  • d7l4bj_ is new in SCOPe 2.08-stable