Lineage for d7jtoj_ (7jto J:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931223Protein Elongin B [54246] (2 species)
  7. 2931224Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries)
  8. 3085670Domain d7jtoj_: 7jto J: [421987]
    Other proteins in same PDB: d7jtob_, d7jtok_, d7jtol_
    automated match to d1lqba_
    complexed with edo, gol, na, scn, vka

Details for d7jtoj_

PDB Entry: 7jto (more details), 1.7 Å

PDB Description: crystal structure of protac ms33 in complex with the wd repeat- containing protein 5 and pvhl:elonginc:elonginb
PDB Compounds: (J:) Elongin-B

SCOPe Domain Sequences for d7jtoj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jtoj_ d.15.1.1 (J:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d7jtoj_:

Click to download the PDB-style file with coordinates for d7jtoj_.
(The format of our PDB-style files is described here.)

Timeline for d7jtoj_:

  • d7jtoj_ is new in SCOPe 2.08-stable