Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Elongin B [54246] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries) |
Domain d7jtoj_: 7jto J: [421987] Other proteins in same PDB: d7jtob_, d7jtok_, d7jtol_ automated match to d1lqba_ complexed with edo, gol, na, scn, vka |
PDB Entry: 7jto (more details), 1.7 Å
SCOPe Domain Sequences for d7jtoj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7jtoj_ d.15.1.1 (J:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvm
Timeline for d7jtoj_: