Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (94 species) not a true protein |
Species Campylobacter jejuni [TaxId:192222] [268320] (5 PDB entries) |
Domain d7l4bc_: 7l4b C: [421984] automated match to d3m5va_ complexed with act, edo, kpi, mg, pge |
PDB Entry: 7l4b (more details), 2.42 Å
SCOPe Domain Sequences for d7l4bc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7l4bc_ c.1.10.0 (C:) automated matches {Campylobacter jejuni [TaxId: 192222]} kniiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehrtc ieiavetckgtkvkvlagagsnatheavglakfakehgadgilsvapyynkptqqglyeh ykaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvxeasgnidkcvdllahe prmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindelyn inkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf
Timeline for d7l4bc_: