Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily) membrane all-alpha fold |
Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) |
Family f.3.1.0: automated matches [254203] (1 protein) not a true family |
Protein automated matches [254444] (10 species) not a true protein |
Species Rhodospirillum rubrum [TaxId:269796] [421717] (1 PDB entry) |
Domain d7eqdb_: 7eqd B: [421963] Other proteins in same PDB: d7eqd1_, d7eqd3_, d7eqd5_, d7eqd7_, d7eqd9_, d7eqda_, d7eqdd_, d7eqdf_, d7eqdi_, d7eqdk_, d7eqdl_, d7eqdm_, d7eqdo_, d7eqdq_, d7eqds_, d7eqdu_, d7eqdw_, d7eqdy_ automated match to d1wrga_ complexed with 07d, 08i, cdl, crt, fe, lmt, pef, pgv, rq0, u10 |
PDB Entry: 7eqd (more details), 2.76 Å
SCOPe Domain Sequences for d7eqdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7eqdb_ f.3.1.0 (B:) automated matches {Rhodospirillum rubrum [TaxId: 269796]} itegeakefhkiftssilvffgvaafahllvwiwrpwvpgpngys
Timeline for d7eqdb_:
View in 3D Domains from other chains: (mouse over for more information) d7eqd0_, d7eqd1_, d7eqd2_, d7eqd3_, d7eqd4_, d7eqd5_, d7eqd6_, d7eqd7_, d7eqd8_, d7eqd9_, d7eqda_, d7eqdd_, d7eqde_, d7eqdf_, d7eqdg_, d7eqdi_, d7eqdj_, d7eqdk_, d7eqdl_, d7eqdm_, d7eqdn_, d7eqdo_, d7eqdp_, d7eqdq_, d7eqdr_, d7eqds_, d7eqdt_, d7eqdu_, d7eqdv_, d7eqdw_, d7eqdx_, d7eqdy_, d7eqdz_ |