SCOPe 2.08: Domain d7eqdb_: 7eqd B:

Lineage for d7eqdb_ (7eqd B:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
   membrane all-alpha fold

4. Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families)

5. Family f.3.1.0: automated matches [254203] (1 protein)
   not a true family

6. Protein automated matches [254444] (10 species)
   not a true protein

7. Species Rhodospirillum rubrum [TaxId:269796] [421717] (1 PDB entry)

8. Domain d7eqdb_: 7eqd B: [421963]
   Other proteins in same PDB: d7eqd1_, d7eqd3_, d7eqd5_, d7eqd7_, d7eqd9_, d7eqda_, d7eqdd_, d7eqdf_, d7eqdi_, d7eqdk_, d7eqdl_, d7eqdm_, d7eqdo_, d7eqdq_, d7eqds_, d7eqdu_, d7eqdw_, d7eqdy_
   automated match to d1wrga_
   complexed with 07d, 08i, cdl, crt, fe, lmt, pef, pgv, rq0, u10

Details for d7eqdb_

PDB Entry: 7eqd, 2.76 Å

PDB Description: structure of photosynthetic lh1-rc super-complex of rhodospirillum rubrum

PDB Compounds: (B:) Light-harvesting protein B-870 beta chain

SCOPe Domain Sequences for d7eqdb_:

Sequence; same for both SEQRES and ATOM records:

>d7eqdb_ f.3.1.0 (B:) automated matches {Rhodospirillum rubrum [TaxId: 269796]}
itegeakefhkiftssilvffgvaafahllvwiwrpwvpgpngys

Timeline for d7eqdb_:

• d7eqdb_ is new in SCOPe 2.08-stable