SCOPe 2.08: Domain d7kq9b_: 7kq9 B:

Lineage for d7kq9b_ (7kq9 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (4 species)

7. Species Salmonella typhimurium [TaxId:90371] [53689] (66 PDB entries)

8. Domain d7kq9b_: 7kq9 B: [421951]
   Other proteins in same PDB: d7kq9a_
   automated match to d6xe3b_
   complexed with 0jo, br, cl, cs, dms, edo, peg, ser; mutant

Details for d7kq9b_

PDB Entry: 7kq9, 1.5 Å

PDB Description: the aminoacrylate form of the beta-q114a mutant tryptophan synthase at 1.50 angstrom resolution with cesium ion at the metal coordination site

PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d7kq9b_:

Sequence; same for both SEQRES and ATOM records:

>d7kq9b_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagahgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkarg

Timeline for d7kq9b_:

• d7kq9b_ is new in SCOPe 2.08-stable