Lineage for d7jujd_ (7juj D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926815Protein Cruzain [54020] (1 species)
  7. 2926816Species Trypanosoma cruzi [TaxId:5693] [54021] (29 PDB entries)
  8. 3085609Domain d7jujd_: 7juj D: [421926]
    automated match to d1ewla_
    complexed with gn9, k

Details for d7jujd_

PDB Entry: 7juj (more details), 2.2 Å

PDB Description: cruzain bound to gallinamide inhibitor
PDB Compounds: (D:) Cruzipain

SCOPe Domain Sequences for d7jujd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jujd_ d.3.1.1 (D:) Cruzain {Trypanosoma cruzi [TaxId: 5693]}
apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii
knswttqwgeegyiriakgsnqclvkeeassavvg

SCOPe Domain Coordinates for d7jujd_:

Click to download the PDB-style file with coordinates for d7jujd_.
(The format of our PDB-style files is described here.)

Timeline for d7jujd_:

  • d7jujd_ is new in SCOPe 2.08-stable