Lineage for d7f16g_ (7f16 G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733784Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
    automatically mapped to Pfam PF00631
  5. 2733785Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins)
  6. 2733786Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. 2733787Species Cow (Bos taurus) [TaxId:9913] [48673] (72 PDB entries)
  8. 3085483Domain d7f16g_: 7f16 G: [421800]
    Other proteins in same PDB: d7f16n1, d7f16n2
    automated match to d2trcg_
    complexed with clr, plm

Details for d7f16g_

PDB Entry: 7f16 (more details), 2.8 Å

PDB Description: cryo-em structure of parathyroid hormone receptor type 2 in complex with a tuberoinfundibular peptide of 39 residues and g protein
PDB Compounds: (G:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

SCOPe Domain Sequences for d7f16g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7f16g_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
tasiaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfr

SCOPe Domain Coordinates for d7f16g_:

Click to download the PDB-style file with coordinates for d7f16g_.
(The format of our PDB-style files is described here.)

Timeline for d7f16g_:

  • d7f16g_ is new in SCOPe 2.08-stable