Class a: All alpha proteins [46456] (290 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (99 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [196470] (52 PDB entries) |
Domain d7e7fa_: 7e7f A: [421746] automated match to d7m8va_ complexed with chd, gol, hem, myt; mutant |
PDB Entry: 7e7f (more details), 1.4 Å
SCOPe Domain Sequences for d7e7fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7e7fa_ a.104.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vprtvlpfeamprrpgnrrnrlnqirreqgyedlhlevhqtfqelgpifrydlggagmvc vmlpedveklqqvdslhphrmslepwvayrqhrghkcgvfllngpewrfnrlrlnpevls pnavqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfgerlg lvghspssaslnflhalevmfkstvqlmfmprsnsrntspkvwkehfeawdcifqygdnc iqkiyqelafsrpqqytsivaelllnaelspdaikansmeltagsvdttvfpllmtlfel arnpnvqqalrqeslaaaasisehpqkattelpllraalketlrlypvglflervassdl vlqnyhipagtlvrvflyslgrnpalfprperynpqrwldirgsgrnfyhvpfgfgmrqc lgrrlaeaemllllhhvlkhlqvetltqedikmvysfilrpsmfplltfrai
Timeline for d7e7fa_: