Lineage for d7ek5c_ (7ek5 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704249Species Kuruma prawn (Marsupenaeus japonicus) [TaxId:27405] [356321] (5 PDB entries)
  8. 3085378Domain d7ek5c_: 7ek5 C: [421695]
    automated match to d6a4ua_
    complexed with cd, fe

Details for d7ek5c_

PDB Entry: 7ek5 (more details), 3 Å

PDB Description: prawn ferritin to coordinate with heavy metal ions
PDB Compounds: (C:) Ferritin

SCOPe Domain Sequences for d7ek5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ek5c_ a.25.1.0 (C:) automated matches {Kuruma prawn (Marsupenaeus japonicus) [TaxId: 27405]}
asqvrqnyhedceasinkqinmelyasyvylsmayyferddvalpgfakffkessdeere
haqtfmkyqnkrggrivlqqiaapsmrewgtglealqaaldlekqvnqsllelhstasgn
ndphltklledeyleeqvdsikkigdmitklkragptglgeymfdkeln

SCOPe Domain Coordinates for d7ek5c_:

Click to download the PDB-style file with coordinates for d7ek5c_.
(The format of our PDB-style files is described here.)

Timeline for d7ek5c_:

  • d7ek5c_ is new in SCOPe 2.08-stable