Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (60 species) not a true protein |
Species Kuruma prawn (Marsupenaeus japonicus) [TaxId:27405] [356321] (5 PDB entries) |
Domain d7ek7a_: 7ek7 A: [421694] automated match to d6a4ua_ complexed with hg |
PDB Entry: 7ek7 (more details), 2.7 Å
SCOPe Domain Sequences for d7ek7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ek7a_ a.25.1.0 (A:) automated matches {Kuruma prawn (Marsupenaeus japonicus) [TaxId: 27405]} asqvrqnyhedceasinkqinmelyasyvylsmayyferddvalpgfakffkessdeere haqtfmkyqnkrggrivlqqiaapsmrewgtglealqaaldlekqvnqsllelhstasgn ndphltklledeyleeqvdsikkigdmitklkragptglgeymfdkeln
Timeline for d7ek7a_: