Lineage for d7efvd_ (7efv D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2689048Protein automated matches [190531] (23 species)
    not a true protein
  7. 3085297Species Leptolyngbya sp. [TaxId:1080068] [421614] (3 PDB entries)
  8. 3085374Domain d7efvd_: 7efv D: [421691]
    automated match to d1jbob_
    complexed with cyc, men

Details for d7efvd_

PDB Entry: 7efv (more details), 2.77 Å

PDB Description: crystal structure of octameric state of c-phycocyanin from thermoleptolyngbya sp. o-77
PDB Compounds: (D:) C-phycocyanin beta chain

SCOPe Domain Sequences for d7efvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7efvd_ a.1.1.3 (D:) automated matches {Leptolyngbya sp. [TaxId: 1080068]}
mldafakvvsqadtkgeflssaqldalsnvvkdgskrldavnrmtsnastivanaarslf
eeqpqliqpggnaytnrrmaaclrdmeiilryvtyatlagdssvlddrclnglretyqal
gvpggsvaagvakmkdaaiaivndpngitkgdcsalvseiasyfdraaaava

SCOPe Domain Coordinates for d7efvd_:

Click to download the PDB-style file with coordinates for d7efvd_.
(The format of our PDB-style files is described here.)

Timeline for d7efvd_:

  • d7efvd_ is new in SCOPe 2.08-stable