Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.3: CoaB-like [102645] (2 families) combination of the Rossmann-like and Ribokinase-like topologies; mixed beta-sheet of 8 strands, order 32145678, strand 7 is antiparallel to the rest |
Family c.72.3.1: CoaB-like [102646] (3 proteins) Pfam PF04127 |
Protein automated matches [421635] (1 species) not a true protein |
Species Homo sapiens [TaxId:9606] [421636] (1 PDB entry) |
Domain d7edzc_: 7edz C: [421669] automated match to d1p9ob_ complexed with anp, gol, j1o, mg, so4 |
PDB Entry: 7edz (more details), 1.95 Å
SCOPe Domain Sequences for d7edzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7edzc_ c.72.3.1 (C:) automated matches {Homo sapiens [TaxId: 9606]} dpvaefpqppgaarwaevmarfaarlgaqgrrvvlvtsggtkvplearpvrfldnfssgr rgatsaeaflaagygvlflyrarsafpyahrfppqtwlsalrpsgpalsgllsleaeena lpgfaealrsyqeaaaagtflvvefttladylhllqaaaqalnplgpsamfylaaavsdf yvpvsempehkiqssggplqitmkmvpkllsplvkdwapkafiisfkletdpaivinrar kaleiyqhqvvvanilesrqsfvlivtkdsetklllseeeiekgveieekivdnlqsrht afig
Timeline for d7edzc_: