Lineage for d7edzc_ (7edz C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2905091Superfamily c.72.3: CoaB-like [102645] (2 families) (S)
    combination of the Rossmann-like and Ribokinase-like topologies; mixed beta-sheet of 8 strands, order 32145678, strand 7 is antiparallel to the rest
  5. 2905092Family c.72.3.1: CoaB-like [102646] (3 proteins)
    Pfam PF04127
  6. 3085318Protein automated matches [421635] (1 species)
    not a true protein
  7. 3085319Species Homo sapiens [TaxId:9606] [421636] (1 PDB entry)
  8. 3085352Domain d7edzc_: 7edz C: [421669]
    automated match to d1p9ob_
    complexed with anp, gol, j1o, mg, so4

Details for d7edzc_

PDB Entry: 7edz (more details), 1.95 Å

PDB Description: crystal structure of human ppcs in complex with p-hopan and amppnp
PDB Compounds: (C:) Phosphopantothenate--cysteine ligase

SCOPe Domain Sequences for d7edzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7edzc_ c.72.3.1 (C:) automated matches {Homo sapiens [TaxId: 9606]}
dpvaefpqppgaarwaevmarfaarlgaqgrrvvlvtsggtkvplearpvrfldnfssgr
rgatsaeaflaagygvlflyrarsafpyahrfppqtwlsalrpsgpalsgllsleaeena
lpgfaealrsyqeaaaagtflvvefttladylhllqaaaqalnplgpsamfylaaavsdf
yvpvsempehkiqssggplqitmkmvpkllsplvkdwapkafiisfkletdpaivinrar
kaleiyqhqvvvanilesrqsfvlivtkdsetklllseeeiekgveieekivdnlqsrht
afig

SCOPe Domain Coordinates for d7edzc_:

Click to download the PDB-style file with coordinates for d7edzc_.
(The format of our PDB-style files is described here.)

Timeline for d7edzc_:

  • d7edzc_ is new in SCOPe 2.08-stable