SCOPe 2.08: Domain d7ea6d2: 7ea6 D:113-197

Lineage for d7ea6d2 (7ea6 D:113-197)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d7ea6d2: 7ea6 D:113-197 [421661]
Other proteins in same PDB: d7ea6a1, d7ea6b1, d7ea6d1, d7ea6e1
automated match to d6eh4d2

Details for d7ea6d2

PDB Entry: 7ea6 (more details), 2.18 Å

PDB Description: crystal structure of tcr-017 ectodomain

PDB Compounds: (D:) T cell receptor 017 alpha chain

SCOPe Domain Sequences for d7ea6d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ea6d2 b.1.1.2 (D:113-197) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedt

SCOPe Domain Coordinates for d7ea6d2:

Click to download the PDB-style file with coordinates for d7ea6d2.
(The format of our PDB-style files is described here.)

Timeline for d7ea6d2: