Lineage for d7ea7a_ (7ea7 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) 
Family d.15.1.3: GABARAP-like [54253] (4 proteins)
intracellular membrane trafficking and fusion proteins
automatically mapped to Pfam PF02991
Protein GABA(A) receptor associated protein GABARAP [69658] (3 species) Species Human (Homo sapiens) [TaxId:9606] [69659] (9 PDB entries) 
Domain d7ea7a_: 7ea7 A: [421620]
automated match to d1gnua_
Details for d7ea7a_
PDB Entry: 7ea7 (more details), 2.69 Å
PDB Description: crystal structure of nap1 lir in complex with gabarap
PDB Compounds: (A:) Gamma-aminobutyric acid receptor-associated proteinSCOPe Domain Sequences for d7ea7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ea7a_ d.15.1.3 (A:) GABA(A) receptor associated protein GABARAP {Human (Homo sapiens) [TaxId: 9606]}
mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvyg
SCOPe Domain Coordinates for d7ea7a_:
Click to download the PDB-style file with coordinates for d7ea7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d7ea7a_:
- d7ea7a_ is new in SCOPe 2.08-stable
View in 3D
