Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (73 species) not a true protein |
Species Salix babylonica [TaxId:75706] [420115] (8 PDB entries) |
Domain d7dw2d2: 7dw2 D:85-222 [421609] Other proteins in same PDB: d7dw2a1, d7dw2b1, d7dw2c1, d7dw2d1 automated match to d5g5ea2 |
PDB Entry: 7dw2 (more details), 1.74 Å
SCOPe Domain Sequences for d7dw2d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dw2d2 a.45.1.0 (D:85-222) automated matches {Salix babylonica [TaxId: 75706]} ilpsdpydralarfwaayldekwfptmrniaaakdeearkalidqvgeglvlledafskc skgkgffggdqigyldiafgsflgwlraiekmngvklmdetrtpgllkwansfsshpavk dvfpeteklvefakvlak
Timeline for d7dw2d2: