SCOPe 2.08: Domain d7dw2d2: 7dw2 D:85-222

Lineage for d7dw2d2 (7dw2 D:85-222)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Salix babylonica [TaxId:75706] [420115] (8 PDB entries)

8. Domain d7dw2d2: 7dw2 D:85-222 [421609]
   Other proteins in same PDB: d7dw2a1, d7dw2b1, d7dw2c1, d7dw2d1
   automated match to d5g5ea2

Details for d7dw2d2

PDB Entry: 7dw2, 1.74 Å

PDB Description: crystal structure of a glutathione s-transferase sbgstu6 from salix babylonica

PDB Compounds: (D:) glutathione s-transferase

SCOPe Domain Sequences for d7dw2d2:

Sequence; same for both SEQRES and ATOM records:

>d7dw2d2 a.45.1.0 (D:85-222) automated matches {Salix babylonica [TaxId: 75706]}
ilpsdpydralarfwaayldekwfptmrniaaakdeearkalidqvgeglvlledafskc
skgkgffggdqigyldiafgsflgwlraiekmngvklmdetrtpgllkwansfsshpavk
dvfpeteklvefakvlak

Timeline for d7dw2d2:

• d7dw2d2 is new in SCOPe 2.08-stable