Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily) core: alpha3-beta3-alpha4; one side of beta-sheet is exposed |
Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) |
Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins) |
Protein Cre recombinase [56355] (1 species) |
Species Bacteriophage P1 [TaxId:10678] [56356] (20 PDB entries) Uniprot P06956 20-341 |
Domain d2crxb2: 2crx B:130-341 [42160] Other proteins in same PDB: d2crxa1, d2crxb1 protein/DNA complex |
PDB Entry: 2crx (more details), 2.5 Å
SCOPe Domain Sequences for d2crxb2:
Sequence, based on SEQRES records: (download)
>d2crxb2 d.163.1.1 (B:130-341) Cre recombinase {Bacteriophage P1 [TaxId: 10678]} rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei mqaggwtnvnivmnyirnldsetgamvrlled
>d2crxb2 d.163.1.1 (B:130-341) Cre recombinase {Bacteriophage P1 [TaxId: 10678]} rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd ggrmlihigagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaapsatsqls tralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipeimqaggwtn vnivmnyirgamvrlled
Timeline for d2crxb2: