Lineage for d7e84j_ (7e84 J:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711650Species Human (Homo sapiens) [TaxId:9606] [189519] (58 PDB entries)
  8. 3085252Domain d7e84j_: 7e84 J: [421569]
    automated match to d2jula_

Details for d7e84j_

PDB Entry: 7e84 (more details), 3.1 Å

PDB Description: cryoem structure of human kv4.2-kchip1 complex
PDB Compounds: (J:) Kv channel-interacting protein 1

SCOPe Domain Sequences for d7e84j_:

Sequence, based on SEQRES records: (download)

>d7e84j_ a.39.1.0 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pegleqleaqtnftkrelqvlyrgfknecpsgvvnedtfkqiyaqffphgdastyahylf
nafdttqtgsvkfedfvtalsillrgtvheklrwtfnlydinkdgyinkeemmdivkaiy
dmmgkytypvlkedtprqhvdvffqkmdknkdgivtldeflescqeddnimrslqlfqnv
m

Sequence, based on observed residues (ATOM records): (download)

>d7e84j_ a.39.1.0 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pegleqleaqtnftkrelqvlyrgfknecpsgvvnedtfkqiyaqffphgdastyahylf
nafdttqtgsvkfedfvtalsillrgtvheklrwtfnlydinkdgyinkeemmdivkaiy
dmmgkytypvlkedtprqhvdvffqkmdknktldeflescqeddnimrslqlfqnvm

SCOPe Domain Coordinates for d7e84j_:

Click to download the PDB-style file with coordinates for d7e84j_.
(The format of our PDB-style files is described here.)

Timeline for d7e84j_:

  • d7e84j_ is new in SCOPe 2.08-stable