Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
Protein automated matches [190590] (26 species) not a true protein |
Species Oligobrachia mashikoi [TaxId:55676] [187601] (8 PDB entries) |
Domain d7e97a_: 7e97 A: [421567] automated match to d2zs0a_ complexed with hem, oxy |
PDB Entry: 7e97 (more details), 2.7 Å
SCOPe Domain Sequences for d7e97a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7e97a_ a.1.1.0 (A:) automated matches {Oligobrachia mashikoi [TaxId: 55676]} vcnrleqilvktqwaqsygeaenraafsrdlfselfniqgssralfsgvgvddmnsaaft ahclrvtgalnrlisqldqqatinadlahlagqhasrnldasnfaamgqavmsvvpthld cfnqhawgecyeriasgisg
Timeline for d7e97a_: