Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (36 species) not a true protein |
Species Human coronavirus nl63 [TaxId:277944] [421509] (5 PDB entries) |
Domain d7e6ma_: 7e6m A: [421558] automated match to d6w81a_ |
PDB Entry: 7e6m (more details), 1.83 Å
SCOPe Domain Sequences for d7e6ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7e6ma_ b.47.1.0 (A:) automated matches {Human coronavirus nl63 [TaxId: 277944]} glkkmaqpsgcvercvvrvcygstvlngvwlgdtvtcprhviapsttvlidydhaystmr lhnfsvshngvflgvvgvtmhgsvlrikvsqsnvhtpkhvfktlkpgdsfnilacyegia sgvfgvnlrtnftikgsfingacgspgynvrndgtvefcylhqielgsgahvgsdftgsv ygnfddqpslqvesanlmlsdnvvaflyaallngcrwwlcstrvnvdgfnewamangyts vssvecysilaaktgvsveqllasiqhlhegfggknilgysslcdeftlaevvkqmygv
Timeline for d7e6ma_: