Lineage for d7ebma_ (7ebm A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916405Species Vibrio harveyi [TaxId:673519] [348941] (10 PDB entries)
  8. 3085240Domain d7ebma_: 7ebm A: [421557]
    automated match to d5hm4b_
    complexed with ca, cl, edo, mg, nag; mutant

Details for d7ebma_

PDB Entry: 7ebm (more details), 1.9 Å

PDB Description: w363a mutant of chitin-specific solute binding protein from vibrio harveyi in complex with chitobiose.
PDB Compounds: (A:) Peptide ABC transporter, periplasmic peptide-binding protein

SCOPe Domain Sequences for d7ebma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ebma_ c.94.1.0 (A:) automated matches {Vibrio harveyi [TaxId: 673519]}
aerseltihpkefttfvrnfnpflgatnlhtttdfiyeplvvfnemhgntpvfrlaenfq
msddlmsvtfdirkgvkwsdgeaftaddvvysfnlvkekpeldqsginswvtgvekvndy
qvkfrlseansnvpyeiakvpvvpkhvwskvkdpstftnenpvgsgpftvidtftpqlyi
qcenpnywdaanldvdclrvpqianndqflgkvvngemdwtssfvpdidrtyaaaspkhh
ywyppagtqafvvnfknpdaaknealtnvdfrrafsmaldrqtiidiafygggtvndfas
glgyafeawsdekthdkfkaynsynaegakkllakagfkdvnkdgfvdtpsgksfelliq
spngatdfnntvqlaveqlaevgikarartpdfsvynqamlegtydvaytnyfhgadpyt
ywnsaynsalqsgdgmprfamhfyknekldgllnsfyktadkqeqleiahgiqqiiaqdq
vtipvlsgaymyqynttrftgwwneenpkgrpniwagiperllhvldlkp

SCOPe Domain Coordinates for d7ebma_:

Click to download the PDB-style file with coordinates for d7ebma_.
(The format of our PDB-style files is described here.)

Timeline for d7ebma_:

  • d7ebma_ is new in SCOPe 2.08-stable