SCOPe 2.08: Domain d7e5ol_: 7e5o L:

Lineage for d7e5ol_ (7e5o L:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d7e5ol_: 7e5o L: [421540]
   Other proteins in same PDB: d7e5oa_
   automated match to d7orbb_

Details for d7e5ol_

PDB Entry: 7e5o, 2.8 Å

PDB Description: crystal structure of sars-cov-2 rbd in complex with antibody nt-193

PDB Compounds: (L:) NT-193 Light chain

SCOPe Domain Sequences for d7e5ol_:

Sequence; same for both SEQRES and ATOM records:

>d7e5ol_ b.1.1.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
airmtqspsamsasvgdrvtvtcrasqgignylawfqlkpgkvpkrliyaasslqsgvpa
rfsgggsgteftltisslqpedfatyyclqhgflpwtfgqgtkleikrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrge

Timeline for d7e5ol_:

• d7e5ol_ is new in SCOPe 2.08-stable