SCOP 1.75: Domain d1aihd_: 1aih D:

Lineage for d1aihd_ (1aih D:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
   core: alpha3-beta3-alpha4; one side of beta-sheet is exposed

4. Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families)

5. Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins)

6. Protein Integrase [56351] (1 species)

7. Species Bacteriophage HP1 [TaxId:10690] [56352] (1 PDB entry)

8. Domain d1aihd_: 1aih D: [42152]
   complexed with mg, so4

Details for d1aihd_

PDB Entry: 1aih, 2.5 Å

PDB Description: catalytic domain of bacteriophage hp1 integrase

PDB Compounds: (D:) hp1 integrase

SCOP Domain Sequences for d1aihd_:

Sequence; same for both SEQRES and ATOM records:

>d1aihd_ d.163.1.1 (D:) Integrase {Bacteriophage HP1 [TaxId: 10690]}
etelaflyerdiyrllaecdnsrnpdlglivriclatgarwseaetltqsqvmpykitft
ntkskknrtvpisdelfdmlpkkrgrlfndayesfenavlraeielpkgqlthvlrhtfa
shfmmnggnilvlkeilghstiemtmryahfapshlesavkfnplsnpaq

Timeline for d1aihd_:

• d1aihd_ first appeared (with stable ids) in SCOP 1.55
  
• d1aihd_ appears in SCOP 1.73
  
• d1aihd_ appears in SCOPe 2.01
  
• d1aihd_ appears in the current release, SCOPe 2.08