Lineage for d7dvua_ (7dvu A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 3085078Species Streptococcus agalactiae [TaxId:211110] [421395] (3 PDB entries)
  8. 3085150Domain d7dvua_: 7dvu A: [421467]
    automated match to d3broc_
    complexed with cyn, hem

Details for d7dvua_

PDB Entry: 7dvu (more details), 2.1 Å

PDB Description: crystal structure of heme sensor protein pefr in complex with heme and cyanide
PDB Compounds: (A:) HTH marR-type domain-containing protein

SCOPe Domain Sequences for d7dvua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dvua_ a.4.5.0 (A:) automated matches {Streptococcus agalactiae [TaxId: 211110]}
menplqkarilvnqlekyldryakeydvehlagpqghlvmhlykhpdkdmsikdaeeilh
isksvasnlvkrmekngfiaivpsktdkrvkylylthlgkqkatqfeifleklhstmlag
itkeeirttkkvirtlaknmam

SCOPe Domain Coordinates for d7dvua_:

Click to download the PDB-style file with coordinates for d7dvua_.
(The format of our PDB-style files is described here.)

Timeline for d7dvua_:

  • d7dvua_ is new in SCOPe 2.08-stable