Lineage for d7dtnc_ (7dtn C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996833Protein automated matches [190079] (12 species)
    not a true protein
  7. 2997029Species Serratia marcescens [TaxId:615] [186800] (10 PDB entries)
  8. 3085138Domain d7dtnc_: 7dtn C: [421455]
    automated match to d5ev8c_
    complexed with ae3, flc, ocs, zn; mutant

Details for d7dtnc_

PDB Entry: 7dtn (more details), 1.85 Å

PDB Description: crystal structure of metallo-beta-lactamase imp-1 mutant (d120e) in complex with citrate.
PDB Compounds: (C:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d7dtnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dtnc_ d.157.1.1 (C:) automated matches {Serratia marcescens [TaxId: 615]}
slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw
fvergykikgsisshfhsestggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn
ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl
lkskygkaklvvpshsevgdasllkltleqavkglnes

SCOPe Domain Coordinates for d7dtnc_:

Click to download the PDB-style file with coordinates for d7dtnc_.
(The format of our PDB-style files is described here.)

Timeline for d7dtnc_:

  • d7dtnc_ is new in SCOPe 2.08-stable