SCOPe 2.08: Domain d7e1ka_: 7e1k A:

Lineage for d7e1ka_ (7e1k A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins)
   automatically mapped to Pfam PF00540

6. Protein HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) [47838] (1 species)
   topologically similar to one subunit in the interferon-gamma intertwined dimer

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47839] (14 PDB entries)

8. Domain d7e1ka_: 7e1k A: [421433]
   automated match to d2hmxa_
   complexed with ihp

Details for d7e1ka_

PDB Entry: 7e1k, 2.4 Å

PDB Description: crystal structure of pr55gag-matrix domain in complex with ip6 in space group r32

PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d7e1ka_:

Sequence; same for both SEQRES and ATOM records:

>d7e1ka_ a.61.1.1 (A:) HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) {Human immunodeficiency virus type 1 [TaxId: 11676]}
garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil
gqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
t

Timeline for d7e1ka_:

• d7e1ka_ is new in SCOPe 2.08-stable