SCOPe 2.08: Domain d1llca2: 1llc A:165-334

Lineage for d1llca2 (1llc A:165-334)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Lactate dehydrogenase [56339] (20 species)

7. Species Lactobacillus casei [TaxId:1582] [56345] (4 PDB entries)

8. Domain d1llca2: 1llc A:165-334 [42143]
   Other proteins in same PDB: d1llca1
   complexed with afp, so4

Details for d1llca2

PDB Entry: 1llc, 3 Å

PDB Description: structure determination of the allosteric l-lactate dehydrogenase from lactobacillus casei at 3.0 angstroms resolution

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1llca2:

Sequence; same for both SEQRES and ATOM records:

>d1llca2 d.162.1.1 (A:165-334) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
tsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik
edklvkmfedvrdaayeiiklkgatfygiatalariskailndenavlplsvymdgqygi
ndlyigtpavinrngiqnileipltdheeesmqksasqlkkvltdafakndi

Timeline for d1llca2:

• d1llca2 first appeared (with stable ids) in SCOP 1.55, called d1llc_2
  
• d1llca2 appears in SCOPe 2.07