Lineage for d1ldng2 (1ldn G:163-330)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1938736Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1938743Protein Lactate dehydrogenase [56339] (18 species)
  7. 1938747Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries)
  8. 1938754Domain d1ldng2: 1ldn G:163-330 [42139]
    Other proteins in same PDB: d1ldna1, d1ldnb1, d1ldnc1, d1ldnd1, d1ldne1, d1ldnf1, d1ldng1, d1ldnh1
    complexed with fbp, nad, oxm

Details for d1ldng2

PDB Entry: 1ldn (more details), 2.5 Å

PDB Description: structure of a ternary complex of an allosteric lactate dehydrogenase from bacillus stearothermophilus at 2.5 angstroms resolution
PDB Compounds: (G:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1ldng2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldng2 d.162.1.1 (G:163-330) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea
qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge
rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraft

SCOPe Domain Coordinates for d1ldng2:

Click to download the PDB-style file with coordinates for d1ldng2.
(The format of our PDB-style files is described here.)

Timeline for d1ldng2: