Lineage for d1ldnd2 (1ldn D:163-330)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36979Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)
  4. 36980Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) (S)
  5. 36981Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (3 proteins)
  6. 36988Protein Lactate dehydrogenase [56339] (8 species)
  7. 36989Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries)
  8. 36993Domain d1ldnd2: 1ldn D:163-330 [42136]
    Other proteins in same PDB: d1ldna1, d1ldnb1, d1ldnc1, d1ldnd1, d1ldne1, d1ldnf1, d1ldng1, d1ldnh1

Details for d1ldnd2

PDB Entry: 1ldn (more details), 2.5 Å

PDB Description: structure of a ternary complex of an allosteric lactate dehydrogenase from bacillus stearothermophilus at 2.5 angstroms resolution

SCOP Domain Sequences for d1ldnd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldnd2 d.162.1.1 (D:163-330) Lactate dehydrogenase {Bacillus stearothermophilus}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea
qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge
rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraft

SCOP Domain Coordinates for d1ldnd2:

Click to download the PDB-style file with coordinates for d1ldnd2.
(The format of our PDB-style files is described here.)

Timeline for d1ldnd2: