SCOP 1.59: Domain d1ldnb2: 1ldn B:163-330

Lineage for d1ldnb2 (1ldn B:163-330)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)

4. Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)

6. Protein Lactate dehydrogenase [56339] (11 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries)

8. Domain d1ldnb2: 1ldn B:163-330 [42134]
   Other proteins in same PDB: d1ldna1, d1ldnb1, d1ldnc1, d1ldnd1, d1ldne1, d1ldnf1, d1ldng1, d1ldnh1

Details for d1ldnb2

PDB Entry: 1ldn, 2.5 Å

PDB Description: structure of a ternary complex of an allosteric lactate dehydrogenase from bacillus stearothermophilus at 2.5 angstroms resolution

SCOP Domain Sequences for d1ldnb2:

Sequence; same for both SEQRES and ATOM records:

>d1ldnb2 d.162.1.1 (B:163-330) Lactate dehydrogenase {Bacillus stearothermophilus}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea
qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge
rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraft

Timeline for d1ldnb2:

• d1ldnb2 first appeared (with stable ids) in SCOP 1.55
  
• d1ldnb2 appears in SCOP 1.57
  
• d1ldnb2 appears in SCOP 1.61
  
• d1ldnb2 appears in the current release, SCOPe 2.08