Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily) |
Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins) |
Protein Lactate dehydrogenase [56339] (11 species) |
Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries) |
Domain d1ldnb2: 1ldn B:163-330 [42134] Other proteins in same PDB: d1ldna1, d1ldnb1, d1ldnc1, d1ldnd1, d1ldne1, d1ldnf1, d1ldng1, d1ldnh1 |
PDB Entry: 1ldn (more details), 2.5 Å
SCOP Domain Sequences for d1ldnb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldnb2 d.162.1.1 (B:163-330) Lactate dehydrogenase {Bacillus stearothermophilus} tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraft
Timeline for d1ldnb2: