Lineage for d1ldna2 (1ldn A:163-330)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily) Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) 
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins) Protein Lactate dehydrogenase [56339] (10 species) 
Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries) 
Domain d1ldna2: 1ldn A:163-330 [42133]
Other proteins in same PDB: d1ldna1, d1ldnb1, d1ldnc1, d1ldnd1, d1ldne1, d1ldnf1, d1ldng1, d1ldnh1
Details for d1ldna2
PDB Entry: 1ldn (more details), 2.5 Å
PDB Description: structure of a ternary complex of an allosteric lactate dehydrogenase from bacillus stearothermophilus at 2.5 angstroms resolution
SCOP Domain Sequences for d1ldna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldna2 d.162.1.1 (A:163-330) Lactate dehydrogenase {Bacillus stearothermophilus}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea
qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge
rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraft
SCOP Domain Coordinates for d1ldna2:
Click to download the PDB-style file with coordinates for d1ldna2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ldna2:
View in 3D
