Lineage for d1ldg_2 (1ldg 164-329)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138998Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)
  4. 138999Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) (S)
  5. 139000Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
  6. 139007Protein Lactate dehydrogenase [56339] (11 species)
  7. 139047Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [56343] (3 PDB entries)
  8. 139050Domain d1ldg_2: 1ldg 164-329 [42132]
    Other proteins in same PDB: d1ldg_1

Details for d1ldg_2

PDB Entry: 1ldg (more details), 1.74 Å

PDB Description: plasmodium falciparum l-lactate dehydrogenase complexed with nadh and oxamate

SCOP Domain Sequences for d1ldg_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldg_2 d.162.1.1 (164-329) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum)}
ggvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklis
daeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlkkvlicstllegqygh
sdifggtpvvlgangveqvielqlnseekakfdeaiaetkrmkala

SCOP Domain Coordinates for d1ldg_2:

Click to download the PDB-style file with coordinates for d1ldg_2.
(The format of our PDB-style files is described here.)

Timeline for d1ldg_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ldg_1