Lineage for d1ldg_2 (1ldg 164-329)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36979Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)
  4. 36980Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) (S)
  5. 36981Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (3 proteins)
  6. 36988Protein Lactate dehydrogenase [56339] (8 species)
  7. 37011Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [56343] (3 PDB entries)
  8. 37014Domain d1ldg_2: 1ldg 164-329 [42132]
    Other proteins in same PDB: d1ldg_1

Details for d1ldg_2

PDB Entry: 1ldg (more details), 1.74 Å

PDB Description: plasmodium falciparum l-lactate dehydrogenase complexed with nadh and oxamate

SCOP Domain Sequences for d1ldg_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldg_2 d.162.1.1 (164-329) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum)}
ggvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklis
daeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlkkvlicstllegqygh
sdifggtpvvlgangveqvielqlnseekakfdeaiaetkrmkala

SCOP Domain Coordinates for d1ldg_2:

Click to download the PDB-style file with coordinates for d1ldg_2.
(The format of our PDB-style files is described here.)

Timeline for d1ldg_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ldg_1