Lineage for d7dovc_ (7dov C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777391Protein Tumor necrosis factor (TNF) [49848] (3 species)
  7. 3084954Species Danio rerio [TaxId:7955] [421271] (1 PDB entry)
  8. 3084970Domain d7dovc_: 7dov C: [421287]
    automated match to d2tnfa_

Details for d7dovc_

PDB Entry: 7dov (more details), 2.59 Å

PDB Description: the crystal structure of zebrafish tumor necrosis factor alpha
PDB Compounds: (C:) Lymphotoxin-alpha

SCOPe Domain Sequences for d7dovc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dovc_ b.22.1.1 (C:) Tumor necrosis factor (TNF) {Danio rerio [TaxId: 7955]}
aaihltggynsesktldwrddqdqafssgglklvnreiiipddgiyfvysqvslhiscts
elteeqvlmshavmrfsesyggkkplfsairsictqepesenlwyntiylgaafhlregd
rlgtdtttallpmvendngktffgvfgl

SCOPe Domain Coordinates for d7dovc_:

Click to download the PDB-style file with coordinates for d7dovc_.
(The format of our PDB-style files is described here.)

Timeline for d7dovc_:

  • d7dovc_ is new in SCOPe 2.08-stable