Lineage for d6ldh_2 (6ldh 161-329)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36979Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)
  4. 36980Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) (S)
  5. 36981Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (3 proteins)
  6. 36988Protein Lactate dehydrogenase [56339] (8 species)
  7. 37005Species Dogfish (Squalus acanthias) [TaxId:7797] [56342] (3 PDB entries)
  8. 37007Domain d6ldh_2: 6ldh 161-329 [42128]
    Other proteins in same PDB: d6ldh_1

Details for d6ldh_2

PDB Entry: 6ldh (more details), 2 Å

PDB Description: refined crystal structure of dogfish m4 apo-lactate dehydrogenase

SCOP Domain Sequences for d6ldh_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ldh_2 d.162.1.1 (161-329) Lactate dehydrogenase {Dogfish (Squalus acanthias)}
sgcnldsarfrylmgerlgvhscschgwvigehgdsvpsvwsgmnvasiklhpldgtnkd
kqdwkklhkdvvdsayeviklkgytswaiglsvadlaetimknlcrvhpvstmvkdfygi
kdnvflslpcvlndhgisnivkmklkpneeqqlqksattlwdiqkdlkf

SCOP Domain Coordinates for d6ldh_2:

Click to download the PDB-style file with coordinates for d6ldh_2.
(The format of our PDB-style files is described here.)

Timeline for d6ldh_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ldh_1