Lineage for d5ldh_2 (5ldh 163-331)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily) Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) 
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins) Protein Lactate dehydrogenase [56339] (10 species) 
Species Pig (Sus scrofa) [TaxId:9823] [56340] (3 PDB entries) 
Domain d5ldh_2: 5ldh 163-331 [42125]
Other proteins in same PDB: d5ldh_1
Details for d5ldh_2
PDB Entry: 5ldh (more details), 2.7 Å
PDB Description: structure of the active ternary complex of pig heart lactate dehydrogenase with s-lac-nad at 2.7 angstroms resolution
SCOP Domain Sequences for d5ldh_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ldh_2 d.162.1.1 (163-331) Lactate dehydrogenase {Pig (Sus scrofa)}
sgcnldsarfrylmgeklgvhpsschgwilgehgdssvavwsgvnvagvvlqqlnpemgt
dndsenwkevhkmvvesayeviklkgytnwaiglsvadliesmlknlsrihpvstmvqgm
ygienevflslpcvlnargltsvinqklkddevaqlknsadtlwgiqkdlkdl
SCOP Domain Coordinates for d5ldh_2:
Click to download the PDB-style file with coordinates for d5ldh_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5ldh_2:
- d5ldh_2 first appeared (with stable ids) in SCOP 1.55
- d5ldh_2 appears in SCOP 1.59
- d5ldh_2 appears in the current release, SCOPe 2.08, called d5ldha2
View in 3D
