Lineage for d5ldh_2 (5ldh 163-331)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36979Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)
  4. 36980Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) (S)
  5. 36981Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (3 proteins)
  6. 36988Protein Lactate dehydrogenase [56339] (8 species)
  7. 37017Species Pig (Sus scrofa) [TaxId:9823] [56340] (3 PDB entries)
  8. 37022Domain d5ldh_2: 5ldh 163-331 [42125]
    Other proteins in same PDB: d5ldh_1

Details for d5ldh_2

PDB Entry: 5ldh (more details), 2.7 Å

PDB Description: structure of the active ternary complex of pig heart lactate dehydrogenase with s-lac-nad at 2.7 angstroms resolution

SCOP Domain Sequences for d5ldh_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ldh_2 d.162.1.1 (163-331) Lactate dehydrogenase {Pig (Sus scrofa)}
sgcnldsarfrylmgeklgvhpsschgwilgehgdssvavwsgvnvagvvlqqlnpemgt
dndsenwkevhkmvvesayeviklkgytnwaiglsvadliesmlknlsrihpvstmvqgm
ygienevflslpcvlnargltsvinqklkddevaqlknsadtlwgiqkdlkdl

SCOP Domain Coordinates for d5ldh_2:

Click to download the PDB-style file with coordinates for d5ldh_2.
(The format of our PDB-style files is described here.)

Timeline for d5ldh_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ldh_1